Anti- DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestina...
| Catalog Number | Pack Size | List Price* | Quantity | |
|---|---|---|---|---|
| 168763-AF-ML550-100uL | 100ul | 1'054,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Anti- DOG-1 (ANO1, Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1,TAOS2, ORAOV2, TMEM16A) (BSA & Azide Free) (MaxLight 550)
| Category | Antibody |
| Supplier | USBiological |
| Application | IF, IHC, IP, WB |
| Regulatory Status | RUO |
| Species Specificity | Hu |
| Immunogen | Recombinant human DOG-1 protein (clone DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a... |
| Host | Ms |
| Clone Number | [DG1/447 + DOG-1.1 (mixture of 2 clones)] |
| Isotype | IgG1,k |
| Crossreactivity | Hu |
| Clonality | Mab |
| Format | Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550. |
| Grade | Affinity Purified |
| Purity | Purified by Protein A/G affinity chromatography. |
| Storage Conditions | 4°C Do Not Freeze |
| Tech. Data Sheet | View datasheet |
| Link To Supplier | https://www.usbio.net |
| Shipping Details | Blue Ice |
| Material Safety Data Sheet | Download PDF |
