Anti- SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8, MCT3, REM...


Catalog Number Pack Size List Price* Quantity
138347-FITC-100uL 100ul 1'191,00 Add

* CHF, excl. 8.1% VAT and shipping costs


Product Description

Anti- SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8, MCT3, REMP) (FITC)

Category Antibody
Supplier USBiological
Application IHC, WB
Regulatory Status RUO
Species Specificity Hu
Immunogen Synthetic peptide corresponding to aa RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI from the middle region of human SLC16A8.
Host Rb
Isotype IgG
Crossreactivity Bo, Dg, Ho, Gp, Hu, Ms, Rb, Rt
Clonality Pab
Format Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Grade Affinity Purified
Purity Purified by Protein A affinity chromatography.
Storage Conditions -20°C
Tech. Data Sheet View datasheet
Link To Supplier https://www.usbio.net
Shipping Details Blue Ice
Material Safety Data Sheet Download PDF