Anti- SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8, MCT3, REM...
| Catalog Number | Pack Size | List Price* | Quantity | |
|---|---|---|---|---|
| 138347-Biotin-100uL | 100ul | 1'191,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Anti- SLC16A8 (Monocarboxylate Transporter 3, MCT 3, Solute Carrier Family 16 Member 8, MCT3, REMP) (Biotin)
| Category | Antibody |
| Supplier | USBiological |
| Application | IHC, WB |
| Regulatory Status | RUO |
| Species Specificity | Hu |
| Immunogen | Synthetic peptide corresponding to aa RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI from the middle region of human SLC16A8. |
| Host | Rb |
| Isotype | IgG |
| Crossreactivity | Bo, Dg, Ho, Gp, Hu, Ms, Rb, Rt |
| Clonality | Pab |
| Format | Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin. |
| Grade | Affinity Purified |
| Purity | Purified by Protein A affinity chromatography. |
| Storage Conditions | -20°C |
| Tech. Data Sheet | View datasheet |
| Link To Supplier | https://www.usbio.net |
| Shipping Details | Blue Ice |
| Material Safety Data Sheet | Download PDF |
