Anti- SLC39A6 (LIV1, ZIP6, Zinc Transporter ZIP6, Estrogen-regulated Protein LIV-1, Solute Carrie...
Catalog Number | Pack Size | List Price* | Quantity | |
---|---|---|---|---|
138376-APC-100uL | 100ul | 1'191,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Anti- SLC39A6 (LIV1, ZIP6, Zinc Transporter ZIP6, Estrogen-regulated Protein LIV-1, Solute Carrier Family 39 Member 6, Zrt- and Irt-like Protein 6, ZIP-6) (APC)
Category | Antibody |
Supplier | USBiological |
Application | IHC, WB |
Regulatory Status | RUO |
Species Specificity | Hu |
Immunogen | Synthetic peptide corresponding to the middle region, RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN, of human SLC39A6. |
Host | Rb |
Isotype | IgG |
Crossreactivity | Bo, Dg, Ho, Gp, Hu, Ms, Rt, Sh |
Clonality | Pab |
Format | Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC). |
Grade | Affinity Purified |
Purity | Purified by Protein A affinity chromatography. |
Storage Conditions | 4°C Do Not Freeze |
Tech. Data Sheet | View datasheet |
Link To Supplier | https://www.usbio.net |
Shipping Details | Blue Ice |
Material Safety Data Sheet | Download PDF |