Anti- SLC39A6 (LIV1, ZIP6, Zinc Transporter ZIP6, Estrogen-regulated Protein LIV-1, Solute Carrie...
| Catalog Number | Pack Size | List Price* | Quantity | |
|---|---|---|---|---|
| 138376-APC-100uL | 100ul | 1'191,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Anti- SLC39A6 (LIV1, ZIP6, Zinc Transporter ZIP6, Estrogen-regulated Protein LIV-1, Solute Carrier Family 39 Member 6, Zrt- and Irt-like Protein 6, ZIP-6) (APC)
| Category | Antibody |
| Supplier | USBiological |
| Application | IHC, WB |
| Regulatory Status | RUO |
| Species Specificity | Hu |
| Immunogen | Synthetic peptide corresponding to the middle region, RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN, of human SLC39A6. |
| Host | Rb |
| Isotype | IgG |
| Crossreactivity | Bo, Dg, Ho, Gp, Hu, Ms, Rt, Sh |
| Clonality | Pab |
| Format | Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC). |
| Grade | Affinity Purified |
| Purity | Purified by Protein A affinity chromatography. |
| Storage Conditions | 4°C Do Not Freeze |
| Tech. Data Sheet | View datasheet |
| Link To Supplier | https://www.usbio.net |
| Shipping Details | Blue Ice |
| Material Safety Data Sheet | Download PDF |
