Anti- RGN (Regucalcin, RC, Gluconolactonase, GNL, Senescence Marker Protein 30, SMP-30, SMP30)
| Catalog Number | Pack Size | List Price* | Quantity | |
|---|---|---|---|---|
| 397535-100uG | 100ug | 683,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
| Category | Antibody |
| Supplier | USBiological |
| Application | IHC, WB |
| Regulatory Status | RUO |
| Species Specificity | Hu |
| Immunogen | Synthetic peptide corresponding to a sequence YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD of human RGN. |
| Host | Rb |
| Isotype | IgG |
| Crossreactivity | Hu, Ms, Rt |
| Clonality | Pab |
| Format | Supplied as a lyophilized powder from PBS, 0.05% sodium azide., 4% trehalose. Reconstitute with 200ul sterile ddH2O |
| Grade | Affinity Purified |
| Purity | Purified by immunoaffinity chromatography. |
| Storage Conditions | -20°C |
| Tech. Data Sheet | View datasheet |
| Link To Supplier | https://www.usbio.net |
| Shipping Details | Blue Ice |
| Material Safety Data Sheet | Download PDF |
