Anti- TJP1 (Tight Junction Protein ZO-1, Tight Junction Protein 1)
| Catalog Number | Pack Size | List Price* | Quantity | |
|---|---|---|---|---|
| 493926-100uL | 100ul | 753,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
| Category | Antibody |
| Supplier | USBiological |
| Application | WB |
| Regulatory Status | RUO |
| Immunogen | Synthetic peptide mapping to a fragment of residues within AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE corresponding to rat TJP1. |
| Host | Rb |
| Isotype | IgG |
| Crossreactivity | Bo, Dg, Ho, Gp, Hu, Ms, Rb, Rt, Zebrafish |
| Clonality | Pab |
| Format | Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide. |
| Grade | Affinity Purified |
| Purity | Purified by affinity chromatography. |
| Storage Conditions | -20°C |
| Tech. Data Sheet | View datasheet |
| Link To Supplier | https://www.usbio.net |
| Shipping Details | Blue Ice |
| Material Safety Data Sheet | Download PDF |
