Anti-SUR1 [N289/16], Rabbit IgG kappa, Purified
Catalog Number | Pack Size | List Price* | Quantity | |
---|---|---|---|---|
Ab02165-23.0 | 200 μg | 550,00 | Add | |
Ab02165-23.0-BT | 1 mg | 2'170,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Original species and isotype/format: Mouse IgG2a
Category | Antibody |
Supplier | Absolute Antibody |
Application | WB |
Regulatory Status | RUO |
Research Field | potassium, ATP, regulator, channel, insulin, neuroscience |
Species Specificity | Rt |
Immunogen | This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1. |
Host | Rb |
Clone Number | [N289/16] |
Isotype | IgG,k |
Crossreactivity | Rt, Ms, Hm |
Clonality | Recombi |
Format | PBS with 0.02% Proclin 300. |
Purity | Purified |
Conjugation | Unconjugated |
Storage Conditions | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
References | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Disclaimer | Ships in 5-6 weeks |
Tech. Data Sheet | View datasheet |
Link To Supplier | http://absoluteantibody.com |
Shipping Details | Wet Ice |
Material Safety Data Sheet | Download PDF |