Anti-SUR1 [N289/16], Rat IgG2b kappa, Fc Silent™ on heavy chain, Purified


Catalog Number Pack Size List Price* Quantity
Ab02165-8.4 200 μg 550,00 Add
Ab02165-8.4-BT 1 mg 2'170,00 Add

* CHF, excl. 8.1% VAT and shipping costs


Product Description

Original species and isotype/format: Mouse IgG2a

Category Antibody
Supplier Absolute Antibody
Application WB
Regulatory Status RUO
Research Field potassium, ATP, regulator, channel, insulin, neuroscience
Species Specificity Rt
Immunogen This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.
Host Rt
Clone Number [N289/16]
Isotype IgG2b,k
Crossreactivity Rt, Ms, Hm
Clonality Recombi
Format PBS with 0.02% Proclin 300.
Purity Purified
Conjugation Unconjugated
Storage Conditions Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
References This chimeric rat antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
Disclaimer Ships in 5-6 weeks
Tech. Data Sheet View datasheet
Link To Supplier http://absoluteantibody.com
Shipping Details Wet Ice
Material Safety Data Sheet Download PDF