AgRP Polyclonal Antibody

* CHF, excl. 8.1% VAT and shipping costs

Product Description

PA1-18414 detects Agouti Related Protein from mouse, rat and ovine samples. PA1-18414 has been successfully used in immunohistochemistry (paraffin) and immunofluorescence applications. The PA1-18414 immunogen is a synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein conjugated to carrier protein. Reconstitute with 50 µL of distilled water. Store reconstituted antibody in small aliquots at -20 Reconstitute in 50 µL sterile water. Centrifuge to remove any insoluble material. Store lyophilized antibody at 2-8 °C. It is recommended that a thawed sample is stored at 4 °C for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20 °C or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this. Reconstitute in 50 µL sterile water. Centrifuge to remove any insoluble material. Store lyophilized antibody at 2-8 °C. It is recommended that a thawed sample is stored at 4 °C for no longer than 2 weeks. Alloca