Anti- Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, HIF-2a, Endothelial PAS Doma...
Catalog Number | Pack Size | List Price* | Quantity | |
---|---|---|---|---|
H9810-01R-100uG | 100ug | 740,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Anti- Hypoxia Inducible Factor 2a (Hypoxia Inducible Factor 2 alpha, HIF-2a, Endothelial PAS Domain Containing Protein 1, EPAS1, EPAS-1, HIF-2 alpha, HIF2a, HIF1 alpha-like Factor, HLF, Member of PAS Protein 2, MOP2, PASD2)
Category | Antibody |
Supplier | USBiological |
Application | IHC, WB |
Regulatory Status | RUO |
Species Specificity | Rt |
Immunogen | Synthetic peptide corresponding to aa202-240, YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD to rat Hypoxia-inducible factor-2 alpha. |
Host | Rb |
Isotype | IgG |
Crossreactivity | Rt |
Clonality | Pab |
Format | Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% Thimerosal, 0.05% sodium azide. Reconstitute with 100ul of s... |
Grade | Affinity Purified |
Purity | Purified by immunoaffinity chromatography. |
Storage Conditions | -20°C |
Tech. Data Sheet | View datasheet |
Link To Supplier | https://www.usbio.net |
Shipping Details | Blue Ice |
Material Safety Data Sheet | Download PDF |