Anti-Agouti related protein antibody (82-131)
| Catalog Number | Pack Size | List Price* | Quantity | |
|---|---|---|---|---|
| STJA0040720-50uL | 50 µL | 782,00 | Add |
* CHF, excl. 8.1% VAT and shipping costs
Product Description
Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
| Category | Antibody |
| Supplier | St Johns Laboratory |
| Application | IHC-F |
| Regulatory Status | RUO |
| Immunogen | A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to... |
| Host | Gp |
| Isotype | mix |
| Crossreactivity | Hu, Ms, Rt, Sh |
| Clonality | Pab |
| Working Dilution | IHC 1:1000-1:2000 |
| Purity | Whole serum |
| Conjugation | Unconjugated |
| Storage Conditions | Spin vial briefly before opening. Reconstitute in 50 µL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material. Store lyophilized antibody at 2-8°C or lo... |
| Tech. Data Sheet | View datasheet |
| Link To Supplier | https://www.stjohnslabs.com |
| Material Safety Data Sheet | Download PDF |
